PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g01820.12.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YA
Protein Properties Length: 138aa    MW: 15637.1 Da    PI: 10.0849
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g01820.12.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA52.22e-166498136
          CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrk 36
                       +ep+YVNaKQy++Il+RRq+Rak+e+e+kl +k+rk
  Bradi4g01820.12.p 64 EEPVYVNAKQYNAILRRRQSRAKAESERKL-IKGRK 98
                       69****************************.99988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.9E-962120IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115217.1166398IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.5E-1265104IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068606888IPR018362CCAAT-binding factor, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MKTRGRGCWR PEARGTGKET LEGQIAYPSI DPYFYGAYGG QPMMHPPLVG MHPAGLPLPT  60
DAIEEPVYVN AKQYNAILRR RQSRAKAESE RKLIKGRKLR VGQKHKCTTD RADNQVYSPF  120
YILYLHLKID LLHIELS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0096246e-64BT009624.1 Triticum aestivum clone wre1n.pk0143.h2:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237029.12e-81PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X2
SwissprotQ84JP11e-21NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLI1IGG92e-81I1IGG9_BRADI; Uncharacterized protein
STRINGBRADI4G01820.16e-49(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.11e-23nuclear factor Y, subunit A7